PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_23036-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 96aa    MW: 11135.8 Da    PI: 8.4914
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_23036-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++  G g+W++ ++  g+ R++k+c++rw +yl
  TRIUR3_23036-P1 14 KGAWTKEEDQRLIAYIRANGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61
                     79******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-23564IPR009057Homeodomain-like
PROSITE profilePS5129423.268965IPR017930Myb domain
SMARTSM007178.0E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
SuperFamilySSF466891.14E-221588IPR009057Homeodomain-like
CDDcd001671.62E-91661No hitNo description
Gene3DG3DSA:1.10.10.602.6E-106588IPR009057Homeodomain-like
PROSITE profilePS512948.2116696IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MGRSPCCEKE HTNKGAWTKE EDQRLIAYIR ANGEGCWRSL PKAAGLLRCG KSCRLRWMNY  60
LRPDLKRGNF TDEEDELIIR LHSLLGNKPL EEGQYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-17138826100MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3687281e-138AK368728.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2078M17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001170687.12e-57putative MYB DNA-binding domain superfamily protein
SwissprotP813937e-57MYB08_ANTMA; Myb-related protein 308
SwissprotQ9SZP12e-56MYB4_ARATH; Transcription repressor MYB4
TrEMBLM7ZLJ03e-66M7ZLJ0_TRIUA; Transcription repressor MYB4
STRINGMLOC_71041.14e-58(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-57myb domain protein 4